PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Peaxi162Scf00618g00629.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Petunioideae; Petunia
Family MYB_related
Protein Properties Length: 297aa    MW: 32438.1 Da    PI: 10.2321
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Peaxi162Scf00618g00629.1genomeSGNView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.72.3e-125094147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
           Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                              r +WT+ E++++++a +++  + Wk+I + +g  +t  q++s+ qky
  Peaxi162Scf00618g00629.1 50 RESWTEPEHDKFLEALQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 94
                              789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.84E-1644100IPR009057Homeodomain-like
PROSITE profilePS5129414.184599IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.9E-648100IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-184897IPR006447Myb domain, plants
SMARTSM007176.5E-104997IPR001005SANT/Myb domain
PfamPF002494.2E-105094IPR001005SANT/Myb domain
CDDcd001671.05E-75295No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MVMALPNLGS FSNPTVAVAA AATGSNSNPL SPSDDPSKKI RKPYTITKSR ESWTEPEHDK  60
FLEALQLFDR DWKKIEAFVG SKTVIQIRSH AQKYFLKVQK SGTNEHLPPP RPKRKAAHPY  120
PQKASKSAPA VSAVPAPFQA SLPLPDPGFV KRPDSSLLAS NPITAVSVPS WTDNAVPPVS  180
LSQVKKDNAR ETAQPLANNQ CCSSNESTPR SKATGEVMER IQVPSMRVLP DFAQVYNFIG  240
SVFDPAVTGH LQKLKKMDRI DVETVLLLMR NLSINLTSPD FEHHSSASAI LAILRGN
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00625PBMTransfer from PK02532.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2543601e-54AC254360.3 Solanum lycopersicum strain Heinz 1706 chromosome 6 clone slm-20n17 map 6, complete sequence.
GenBankAC2544091e-54AC254409.2 Solanum lycopersicum strain Heinz 1706 chromosome 6 clone slm-45k12 map 6, complete sequence.
GenBankAC2544211e-54AC254421.3 Solanum lycopersicum strain Heinz 1706 chromosome 6 clone hba-44l22 map 6, complete sequence.
GenBankAC2544641e-54AC254464.2 Solanum lycopersicum strain Heinz 1706 chromosome 6 clone slm-62j20 map 6, complete sequence.
GenBankAC2544931e-54AC254493.3 Solanum lycopersicum strain Heinz 1706 chromosome 6 clone hba-15i11 map 6, complete sequence.
GenBankAC2544981e-54AC254498.2 Solanum lycopersicum strain Heinz 1706 chromosome 6 clone sle-6i6 map 6, complete sequence.
GenBankHG9755181e-54HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016575738.10.0PREDICTED: protein REVEILLE 6 isoform X2
SwissprotQ8H0W31e-105RVE6_ARATH; Protein REVEILLE 6
TrEMBLK4C4Z71e-178K4C4Z7_SOLLC; Uncharacterized protein
STRINGSolyc06g036300.2.11e-178(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9982478
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.25e-84MYB_related family protein